Protein / Label:sp|P04627|ARAF_MOUSE
Description: 
Decoy:false
Note: 
File:MousePlasma_Exp1B9_Results_refined1_2017-12-11_12-14-58.sky.zip
0102030405060708090
MEPPRGPPVSGAEPSRAVGTVKVYLPNKQRTVVTVREGMSVYDSLDKALKVRGLNQDCCVVYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHN
100110120130140150160170180190
FVRKTFFSLAFCDFCLKFLFHGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSIQDLSGGSRQQEAPSNLSVNELLTPQGPSPFTQQRDQEHFSFP
200210220230240250260270280290
APANPPLQRIRSTSTPNVHMVSTTAPMDSSLMQFTAQSFSTDAAGRGGDGAPRGSPSPASVSSGRKSPHSKLPSEQRERKSLADEKKKVKNLGYRDSGYY
300310320330340350360370380390
WEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFD
400410420430440450460470480490
MVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYEL
1
500510520530540550560570580590
MTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIFSNCPKAMRRLLTDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPACLLSAA
600
RLVP
DescriptionSerine/threonine-protein kinase A-Raf
Gene name(s)Araf
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_033833.1
NP_001153117.1
none loaded Q9DBU7
Q9D6R6
Q9CTT5
Q99J44
P04627
B1AUN9
ARAF_MOUSE
ENSMUST00000001155
none loaded GO:0046872
GO:0043066
GO:0033138
GO:0032434
GO:0032006
GO:0005739
GO:0005524
GO:0005057
GO:0004674

Peak Areas

Retention Times