Protein / Label:sp|Q61233|PLSL_MOUSE
Description: 
Decoy:false
Note: 
File:MousePlasmaExp1B7_Results_refined_2017-12-11_12-00-26.sky.zip
0102030405060708090
MARGSVSDEEMMELREAFAKVDTDGNGYISCNELNDLFKAACLPLPGYRVREITENLMATGDLDQDGKISFDEFIKVFHGLKSTEVAKTFRKAINKKEGI
100110120130140150160170180190
CAIGGTSEQSSVGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFNAVGDGIVLCKMINLSVPDTIDERTINKKKLTPFTIQENLNLALNS
200210220230240250260270280290
ASAIGCHVVNIGAEDLKEGKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGCTKITNFSTDIKDSKAYY
300310320330340350360370380390
HLLEQVAPKGDEEGIPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRGNPKLNLAFIANLFNKYPALHKPENQDIDWGALEGETREERTF
400410420430440450460470480490
RNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVDLGKNQAKFSLVGIAGQDLNEGNRTLTLALVWQLMR
1
500510520530540550560570580590
RYTLNILEDIGGGQKVNDDIIVNWVNTTLKEAQKSSSIASFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLDDEEKLNNAKYAISMARKIGARVYAL
600610620
PEDLVEVNPKMVMTVFACLMGKGMKRV
DescriptionPlastin-2
Gene name(s)Lcp1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_032905.2
NP_001234913.1
none loaded Q9CV77
Q8R1X3
Q61233
Q3UE24
PLSL_MOUSE
ENSMUST00000145303
ENSMUST00000131802
ENSMUST00000124499
none loaded GO:0051017
GO:0051015
GO:0033157
GO:0032587
GO:0031100
GO:0030054
GO:0005884
GO:0005829
GO:0005509
GO:0002286
GO:0001891
GO:0001726

Peak Areas

Retention Times