0102030405060708090
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLNWYLQKAGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQTTHVP
1
100110
PTFGGGTKLEIKR
Features
DescriptionIg kappa chain V-II region 26-10
Gene name-
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
none loaded none loaded P01631
KV2A7_MOUSE
none loaded none loaded GO:0003823
Monoclonal antibody
Display Chart Settings
 

Peak Areas

Retention Times