0102030405060708090
MAATVRRQRPRRLLCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYF
100110120130140150160170180190
QHLLGKQADNPHVALYRSRFPEHELIVDPQRQTVRFQISPQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPAFFNQAERRAVLQAARMAGLKVL
200210220230240250260270280290
QLINDNTATALSYGVFRRKDINSTAQNVMFYDMGSGSTVCTIVTYQTVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLREHLAKLFNEQRKGQKAKDVR
300310320330340350360370380390
ENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFDRVPGPVQQALQSAEMSLDQIEQVILVGGATRVPKVQEVLLKAV
400410420430440450460470480490
GKEELGKNINADEAAAMGAVYQAAALSKAFKVKPFVVRDAVIYPILVEFTREVEEEPGLRSLKHNKRVLFSRMGPYPQRKVITFNRYSHDFNFHINYGDL
500510520530540550560570580590
GFLGPEDLRVFGSQNLTTVKLKGVGESFKKYPDYESKGIKAHFNLDESGVLSLDRVESVFETLVEDSPEEESTLTKLGNTISSLFGGGTSSDAKENGTDA
600610620630640650660670680690
VQEEEESPAEGSKDEPAEQGELKEEAEPPAEETSQPPPSEPKGDAAREGEKPDEKESGDKPEAQKPNEKGQAGPEGAAPAPEEDKKPKPARKQKMVEEIG
700710720730740750760770780790
VELAVLDLPDLPEDELARSVQKLEELTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSATSTWLEDEGFGATTVMLKDKLAE
1
800810820830840850860870880890
LRKLCQGLFFRVEERRKWPERLSALDNLLNHSSIFLKGARLIPEMDQVFTEVEMTTLEKVINDTWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDR
900910920930940950960970980990
EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASAGDQEEKVIPPAGQTEEAKPILEPDKEETGTEPADSEPLELGGPGAGPEQEEQSAGQKRPSKNDEL
Features
DescriptionHypoxia up-regulated protein 1 (short name: GRP-170)
Gene nameHyou1
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions Biological Processes
NP_067370.3
none loaded Q3TAL1
Q3TZD0
Q3U1U2
Q64139
Q80X75
Q9JKR6
HYOU1_MOUSE
ENSMUST00000066601
ENSMUST00000160902
ENSMUST00000161318
none loaded GO:0002931
GO:0005524
GO:0005576
GO:0005788
Chaperone
Stress response
Display Chart Settings
 

Peak Areas

Retention Times