View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MATRGTVTDFPGFDGRADAEVLRKAMGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKG
1
101111121131141151161171181191
AGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRS
201211221231241251261271281291
VSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKG
301311
DTSGDYKKALLLLCGGEDD
Features
Descriptionannexin A5 [Source:MGI Symbol;Acc:MGI:106008] (g:27712, t:29266).
Gene nameAnxa5
Organism SOURCE:MGI SYMBOL;ACC:MGI:106008

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
none loaded none loaded P48036
ANXA5_MOUSE
none loaded none loaded none loaded
Display Chart Settings
 

Peak Areas

Retention Times