Protein / Label:sp|Q8BWT1|THIM_MOUSE
Description: 
Decoy:false
Note: 
File:20160720_MousePlasmaExp1Batch5_refined_2017-12-11_11-50-02.sky.zip
0102030405060708090
MALLRGVFIVAAKRTPFGAYGGLLKDFSATDLTEFAARAALSAGKVPPETIDSVIVGNVMQSSSDAAYLARHVGLRVGVPTETGALTLNRLCGSGFQSIV
100110120130140150160170180190
SGCQEICSKDAEVVLCGGTESMSQSPYCVRNVRFGTKFGLDLKLEDTLWAGLTDQHVKLPMGMTAENLAAKYNISREDCDRYALQSQQRWKAANEAGYFN
200210220230240250260270280290
EEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPSVFKKDGTVTAGNASGVSDGAGAVIIASEDAVKKHNFTPLARVVGYFVSGCDPTIMGIGPVPAI
300310320330340350360370380390
NGALKKAGLSLKDMDLIDVNEAFAPQFLSVQKALDLDPSKTNVSGGAIALGHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIALIIQNTA
1
Description3-ketoacyl-CoA thiolase, mitochondrial
Gene name(s)Acaa2
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_803421.1
none loaded Q8JZR8
Q8BWT1
Q3TIT9
THIM_MOUSE
ENSMUST00000041053
none loaded GO:1901029
GO:0006631
GO:0005743
GO:0003988

Peak Areas

Retention Times