View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MAALVALHGVVRRPLLRGLLQEVRCLERSYASKPTLNEVVIVSAIRTPIGSFLGSLASQPATKLGTAAIQGAIEKAGIPKEEVKEVYMGNVIQGGEGQAP
101111121131141151161171181191
TRQATLGAGLPISTPCTTVNKVCASGMKAIMMASQSLMCGHQDVMVAGGMESMSNVPYVMSRGATPYGGVKLEDLIVKDGLTDVYNKIHMGNCAENTAKK
201211221231241251261271281291
MNISRQEQDTYALSSYTRSKEAWDAGKFASEITPITISVKGKPDVVVKEDEEYKRVDFSKVPKLKTVFQKENGTITAANASTLNDGAAALVLMTAEAAQR
301311321331341351361371381391
LNVKPLARIAAFADAAVDPIDFPLAPAYAVPKVLKYAGLKKEDIAMWEVNEAFSVVVLANIKMLEIDPQKVNIHGGAVSLGHPIGMSGARIVVHMAHALK
1
401411421
PGEFGLASICNGGGGASALLIEKL
Features
DescriptionAcetyl-CoA acetyltransferase, mitochondrial
Gene nameAcat1
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
NP_659033.1
none loaded Q3TE92
Q8QZT1
THIL_MOUSE
ENSMUST00000034547
none loaded GO:0001889
GO:0003985
GO:0005743
GO:0005759
GO:0007420
GO:0009725
GO:0014070
GO:0042594
GO:0046872
GO:0050662
GO:0051260
GO:0060612
GO:0072229
Acyltransferase
Transferase
Display Chart Settings
 

Peak Areas

Retention Times