0102030405060708090
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKI
1
100110120130140150
PVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Features
DescriptionMyoglobin
Gene nameMb
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions Biological Processes
NP_038621.2
NP_001157519.1
NP_001157520.1
none loaded P04247
MYG_MOUSE
ENSMUST00000019037
ENSMUST00000166179
ENSMUST00000169226
none loaded GO:0001666
GO:0005344
GO:0005506
GO:0007507
GO:0009725
GO:0019825
GO:0020037
GO:0031444
GO:0042542
GO:0043353
GO:0050873
Muscle protein
Oxygen transport
Transport
Display Chart Settings
 

Peak Areas

Retention Times