View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MAGKKVCIVGSGNWGSAIAKIVGSNAGRLAHFDPRVTMWVFEEDIGGRKLTEIINTQHENVKYLPGHKLPPNVVAIPDVVQAATGADILVFVVPHQFIGK
101111121131141151161171181191
ICDQLKGHLKANTIGISLIKGVDEGPNGLKLISEVIGERLGIPMSVLMGANIASEVAEEKFCETTIGCKDPAQGQLLKDLMQTPNFRITVVQEVDTVEIC
1
201211221231241251261271281291
GALKNIVAVGAGFCDGLGFGDNTKAAVIRLGLMEMIAFAKLFCSGTVSSATFLESCGVADLITTCYGGRNRKVAEAFARTGKSIEQLEKEMLNGQKLQGP
301311321331341
QTARELHSILQHKGLVDKFPLFTAVYKVCYEGQPVGEFIRCLQNHPEHM
Features
DescriptionGlycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic (short name: GPD-C)
Gene nameGpd1
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
NP_034401.1
none loaded P13707
Q3UVM3
Q5DTS5
GPDA_MOUSE
ENSMUST00000023760
none loaded GO:0004367
GO:0004368
GO:0005739
GO:0005829
GO:0006072
GO:0006094
GO:0006116
GO:0006127
GO:0009331
GO:0045821
GO:0046168
GO:0046486
GO:0051287
GO:0071320
GO:0071356
Oxidoreductase
Display Chart Settings
 

Peak Areas

Retention Times