Protein / Label:sp|Q9CQI6|COTL1_MOUSE
Description: 
Decoy:false
Note: 
File:20160720_MousePlasmaExp1Batch5_refined_2017-12-11_11-50-02.sky.zip
0102030405060708090
MATKIDKEACRAAYNLVRDDGSAVIWVTFRYDGATIVPGDQGADYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGEDVSGLQRAKTGTDKTL
100110120130140
VKEVVQNFAKEFVISDRKELEEDFIRSELKKAGGANYDAQSE
1
DescriptionCoactosin-like protein
Gene name(s)Cotl1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_082347.1
none loaded Q544F6
Q9CQI6
Q544F6_MOUSE
COTL1_MOUSE
ENSMUST00000168698
ENSMUST00000034285
none loaded GO:0050832
GO:0031965
GO:0005856
GO:0005737
GO:0003779

Peak Areas

Retention Times