Protein / Label:sp|Q7TPR4|ACTN1_MOUSE
Description: 
Decoy:false
Note: 
File:20160720_MousePlasmaExp1Batch5_refined_2017-12-11_11-50-02.sky.zip
0102030405060708090
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFI
100110120130140150160170180190
ASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDD
200210220230240250260270280290
PLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
300310320330340350360370380390
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFR
400410420430440450460470480490
QKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERT
500510520530540550560570580590
EKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
1
600610620630640650660670680690
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLECDHQLIQEALI
700710720730740750760770780790
FDNKHTNYNMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVD
800810820830840850860870880890
PNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITEDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL
DescriptionAlpha-actinin-1
Gene name(s)Actn1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_598917.1
none loaded Q7TPR4
ACTN1_MOUSE
ENSMUST00000021554
none loaded GO:0070062
GO:0051271
GO:0051017
GO:0051015
GO:0048041
GO:0043197
GO:0042803
GO:0032127
GO:0030865
GO:0030863
GO:0030018
GO:0005925
GO:0005916
GO:0005886
GO:0005634
GO:0005509
GO:0003725
GO:0001726
GO:0001725

Peak Areas

Retention Times