Protein / Label:sp|Q9CY02|AHSP_MOUSE
Description: 
Decoy:false
Note: 
File:20160720_MousePlasmaExp1Batch5_refined_2017-12-11_11-50-02.sky.zip
0102030405060708090
MAPFQSNKDLISTGIKEFNVLLDQQVFDDPLISEEDMVIVVHDWVNLYTNYYKKLVHGEQEEQDRAMTEFQQELSTLGSQFLAKYRTFLKSKEPPSNTLP
1
100
SS
DescriptionAlpha-hemoglobin-stabilizing protein
Gene name(s)Ahsp
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_573508.1
none loaded Q9CY02
O70427
AHSP_MOUSE
none loaded none loaded GO:0050821
GO:0030218
GO:0020027
GO:0006457
GO:0005737

Peak Areas

Retention Times