Protein / Label:sp|O08710|THYG_MOUSE
Description: 
Decoy:false
Note: 
File:20160620_Plasma_Exp1_B4_M1_refined_2017-12-11_11-43-39.sky.zip
0102030405060708090
MTALVLWVSTLLSSVCLVAANIFEYQVDAQPLRPCELQREKAFLKQAEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGREVPGSRQLGRPTVCLSFCQLH
100110120130140150160170180190
KQRILLGSYINSTDALYLPQCQDSGNYAPVQCDLQRVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRNRRLLHGVGDRSPPQCTADGEFMPVQCKFVNT
200210220230240250260270280290
TDMMIFDLIHNYNRFPDAFVTFSSFRGRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT
300310320330340350360370380390
KCEVEQFAATRFGHSYIPRCHRDGHYQTVQCQTEGMCWCVDAQGREVPGTRQQGQPPSCAADQSCALERQQALSRFYFETPDYFSPQDLLSSEDRLAPVS
1
400410420430440450460470480490
GVRSDTSCPPRIKELFVDSGLLRSIAVEHYQRLSESRSLLREAIRAVFPSRELAGLALQFTTNPKRLQQNLFGGTFLANAAQFNLSGALGTRSTFNFSQF
500510520530540550560570580590
FQQFGLPGFLNRDRVTTLAKLLPVRLDSSSTPETLRVSEKTVAMNKRVVGNFGFKVNLQENQDALKFLVSLLELPEFLVFLQRAVSVPEDIARDLGDVME
600610620630640650660670680690
MVFSAQACKQMPGKFFVPSCTAGGSYEDIQCYAGECWCVDSRGKELDGSRVRGGRPRCPTKCEKQRAQMQSLASAQPAGSSFFVPTCTREGYFLPVQCFN
700710720730740750760770780790
SECYCVDTEGQVIPGTQSTVGEAKQCPSVCQLQAEQAFLGVVGVLLSNSSMVPSISNVYIPQCSASGQWRHVQCDGPHEQVFEWYERWKTQNGDGQELTP
800810820830840850860870880890
AALLMKIVSYREVASRNFSLFLQSLYDAGQQRIFPVLAQYPSLQDVPQVVLEGATTPPGENIFLDPYIFWQILNGQLSQYPGPYSDFNMPLEHFNLRSCW
900910920930940950960970980990
CVDEAGQKLDGTQTKPGEIPACPGPCEEVKLRVLKFIKETEEIVSASNASSFPLGESFLVAKGIQLTSEELDLPPQFPSRDAFSEKFLRGGEYAIRLAAQ
1000101010201030104010501060107010801090
STLTFYQSLRASLGKSDGAASLLWSGPYMPQCNMIGGWEPVQCHAGTGQCWCVDGRGEFIPGSLMSRSSQMPQCPTNCELSRASGLISAWKQAGPQRNPG
1100111011201130114011501160117011801190
PGDLFIPVCLQTGEYVRKQTSGTGTWCVDPASGEGMPVNTNGSAQCPGLCDVLKSRALSRKVGLGYSPVCEALDGAFSPVQCDLAQGSCWCVLGSGEEVP
1200121012201230124012501260127012801290
GTRVVGTQPACESPQCPLPFSGSDVADGVIFCETASSSGVTTVQQCQLLCRQGLRSAFSPGPLICSLESQHWVTLPPPRACQRPQLWQTMQTQAHFQLLL
1300131013201330134013501360137013801390
PPGKMCSVDYSGLLQAFQVFILDELIARGFCQIQVKTFGTLVSSTVCDNSSIQVGCLTAERLGVNVTWKLQLEDISVGSLPDLYSIERAVTGQDLLGRFA
1400141014201430144014501460147014801490
DLIQSGRFQLHLDSKTFSADTTLYFLNGDSFVTSPRTQLGCMEGFYRVPTTRQDALGCVKCPEGSFSQDGRCTPCPAGTYQEQAGSSACIPCPRGRTTIT
1500151015201530154015501560157015801590
TGAFSKTHCVTDCQKNEAGLQCDQNGQYQASQKNRDSGEVFCVDSEGRKLQWLQTEAGLSESQCLMIRKFDKAPESKVIFDANSPVIVKSSVPSADSPLV
1600161016201630164016501660167016801690
QCLTDCANDEACSFLTVSTMESEVSCDFYSWTRDNFACVTSDQEQDAMGSLKATSFGSLRCQVKVRNSGKDSLAVYVKKGYESTAAGQKSFEPTGFQNVL
1700171017201730174017501760177017801790
SGLYSPVVFSASGANLTDTHTYCLLACDNDSCCDGFIITQVKGGPTICGLLSSPDILLCHINDWRDTSATQANATCAGVTYDQGSRQMTLSLGGQEFLQG
1800181018201830184018501860187018801890
LALLEGTQDSFTSFQQVYLWKDSDMGSRPESMGCERGMVPRSDFPGDMATELFSPVDITQVIVNTSHSLPSQQYWLFTHLFSAEQANLWCLSRCAQEPIF
1900191019201930194019501960197019801990
CQLADITKSSSLYFTCFLYPEAQVCDNVMESNAKNCSQILPHQPTALFRRKVVLNDRVKNFYTRLPFQKLTGISIRDKVPMSGKLISNGFFECERLCDRD
2000201020202030204020502060207020802090
PCCTGFGFLNVSQLQGGEVTCLTLNSMGIQTCNEESGATWRILDCGSEDTEVHTYPFGWYQKPAVWSDTPSFCPSAALQSLTEEKVTSDSWQTLALSSVI
2100211021202130214021502160217021802190
VDPSIKHFDVAHISTAATSNFSMAQDFCLQQCSRHQDCLVTTLQIQPGVVRCVFYPDIQNCIHSLRSHTCWLLLHEEATYIYRKSGIPLVQSDVTSTPSV
2200221022202230224022502260227022802290
RIDSFGQLQGGSQVIKVGTAWKQVYRFLGVPYAAPPLADNRFRAPEVLNWTGSWDATKPRASCWQPGTRTPTPPQINEDCLYLNVFVPENLVSNASVLVF
2300231023202330234023502360237023802390
FHNTMEMEGSGGQLTIDGSILAAVGNFIVVTANYRLGVFGFLSSGSDEVAGNWGLLDQVAALTWVQSHIGAFGGDPQRVTLAADRSGADVASIHLLISRP
2400241024202430244024502460247024802490
TRLQLFRKALLMGGSALSPAAIISPERAQQQAAALAKEVGCPTSSIQEVVSCLRQKPANILNDAQTKLLAVSGPFHYWGPVVDGQYLRELPSRRLKRPLP
2500251025202530254025502560257025802590
VKVDLLIGGSQDDGLINRAKAVKQFEESQGRTNSKTAFYQALQNSLGGEDSDARILAAAVWYYSLEHSTDDYASFSRALENATRDYFIICPMVNMASLWA
2600261026202630264026502660267026802690
RRTRGNVFMYHVPESYGHGSLELLADVQYAFGLPFYSAYQGQFSTEEQSLSLKVMQYFSNFIRSGNPNYPHEFSRKAAEFATPWPDFIPGAGGESYKELS
2700271027202730274027502760
AQLPNRQGLKQADCSFWSKYIQTLKDADGAKDAQLTKSEEEDLEVGPGLEEDLSGSLEPVPKSYSK
DescriptionThyroglobulin (short name: Tg)
Gene name(s)Tg
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_033401.2
none loaded Q9QWY7
Q2NKY1
O88590
O08710
THYG_MOUSE
ENSMUST00000065916
none loaded GO:0042446
GO:0031641
GO:0030878
GO:0015705
GO:0006590
GO:0005615
GO:0005576

Peak Areas

Retention Times