View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MPPSGLRLLPLLLPLPWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVAGESADPEPEPE
101111121131141151161171181191
ADYYAKEVTRVLMVDRNNAIYEKTKDISHSIYMFFNTSDIREAVPEPPLLSRAELRLQRLKSSVEQHVELYQKYSNNSWRYLGNRLLTPTDTPEWLSFDV
201211221231241251261271281291
TGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGISPKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
1
301311321331341351361371381
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Features
DescriptionTransforming growth factor beta-1 (TGF-beta-1) [Cleaved into: Latency-associated peptide (LAP)]
Gene name
Organism CLEAVED INTO:

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
none loaded none loaded P04202
TGFB1_MOUSE
none loaded none loaded none loaded
Display Chart Settings
 

Peak Areas

Retention Times