0102030405060708090
MRVLSARFRVLLACLALVIPVSETNFLSKERASQVLVRKRRANTLFEETMKGNLERECIEELCNKEEAREVFENNPETDYFYPKYLGCLGAFRVGSFHAA
1 >>
100110120130140150160170180190
RQSANAYPDLRSCVKAISDQCDPIPCNEDGYLACQDGQAAFTCFCKPGWQGDRCQYDVNECKDPSNVNGGCSQICDNTPGSYHCSCKRGFAMLPNKKDCK
>
200210220230240250260270280290
DLDECALKPSVCGTAVCKNIPGDFECECPDGYRYDPSSKSCKDVDECSENMCAQLCVNFPGGYSCYCDGKKGFKLAQDQKSCEGIPVCLSLDLDKNYELL
300310320330340350360370380390
YLAEQFAGVVLYLKFRLPDITRFSAEFDFRTYDSEGIILYAESLDHSNWLLIALRDGKIEVQFKNEFSTQITTGGNVINNGIWNMVSVEELDDSVSIKIA
400410420430440450460470480490
KEAVMNINKLGSLFKPTDGFLDTKIYFAGLPRKVESALIKPINPRLDGCIRGWNLMKQGALGAKEIIEGKQNKHCFLNVEKGSYYPGSGIAQFSIDYNNV
500510520530540550560570580590
TNAEGWQMNVTLNIRPSTGTGVMLALVSGGTVPFALSLVDSRSGTSQDIVVFVENSVVARLEAVSLCSDQQSQLKCNVNRNGLELWTPLRKDVIYSKDLQ
600610620630640650660670
RQLAVLDKAMKRTVATYLGGIPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHKDIRAHSCPSVRKIQKNF
Features
DescriptionVitamin K-dependent protein S
Gene namePros1
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes
NP_035303.1
none loaded P43483
Q08761
PROS_MOUSE
ENSMUST00000023629
none loaded GO:0005509
GO:0005576
GO:0007596
GO:0042730
Blood coagulation
Fibrinolysis
Hemostasis

Peak Areas

Retention Times