View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MAEPQPASSGLTDETAFSCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRVLGLTLLQKLDFPAMKFSLYFLAYEDKNDIPKDKSEKTAWTFSRKATLE
1
101111121131141151161171181
LTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKIATII
Features
DescriptionLactoylglutathione lyase
Gene nameGlo1
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
NP_001107032.1
NP_079650.3
none loaded Q543L3
Q8R3T1
Q9CPU0
A5GZX3
LGUL_MOUSE
A5GZX3_MOUSE
ENSMUST00000024823
ENSMUST00000167624
none loaded GO:0004462
GO:0005975
GO:0006357
GO:0006749
GO:0008270
GO:0009438
GO:0030316
GO:0043066
Lyase
Display Chart Settings
 

Peak Areas

Retention Times