Protein / Label:sp|Q9QZD9|EIF3I_MOUSE
Description: 
Decoy:false
Note: 
File:20160620_Plasma_Exp1_B4_M1_refined_2017-12-11_11-43-39.sky.zip
0102030405060708090
MKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCG
100110120130140150160170180190
FDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDSNEPYMKIPCNDSKITSAVWGPLGECVIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDM
1
200210220230240250260270280290
TMFVTASKDNTAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSY
300310320
SSGGEDGYVRIHYFDPQYFEFEFEA
DescriptionEukaryotic translation initiation factor 3 subunit I (short name: eIF3i)
Gene name(s)Eif3i
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_061269.1
none loaded Q9QZD9
EIF3I_MOUSE
ENSMUST00000102593
none loaded GO:0033290
GO:0016282
GO:0006446
GO:0006413
GO:0005852
GO:0003743
GO:0001731

Peak Areas

Retention Times