Protein / Label:sp|O70370|CATS_MOUSE
Description: 
Decoy:false
Note: 
File:20160620_Plasma_Exp1_B4_M1_refined_2017-12-11_11-43-39.sky.zip
0102030405060708090
MRAPGHAAIRWLFWMPLVCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRM
100110120130140150160170180190
GALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQY
200210220230240250260270280290
IIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGK
1
300310320330
DYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI
DescriptionCathepsin S
Gene name(s)Ctss
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_067256.4
none loaded O70370
O54973
E9QK18
CATS_MOUSE
ENSMUST00000116304
none loaded GO:0050729
GO:0031905
GO:0016020
GO:0008234
GO:0008233
GO:0006508
GO:0005764

Peak Areas

Retention Times