Protein / Label:sp|Q01339|APOH_MOUSE
Description: 
Decoy:false
Note: 
File:20160620_Plasma_Exp1_B4_M1_refined_2017-12-11_11-43-39.sky.zip
0102030405060708090
MVSPVLALFSAFLCHVAIAGRICPKPDDLPFATVVPLKTSYDPGEQIVYSCKPGYVSRGGMRRFTCPLTGMWPINTLRCVPRVCPFAGILENGIVRYTSF
1 >>
100110120130140150160170180190
EYPKNISFACNPGFFLNGTSSSKCTEEGKWSPDIPACARITCPPPPVPKFALLKDYRPSAGNNSLYQDTVVFKCLPHFAMIGNDTVMCTEQGNWTRLPEC
>
200210220230240250260270280290
LEVKCPFPPRPENGYVNYPAKPVLLYKDKATFGCHETYKLDGPEEAECTKTGTWSFLPTCRESCKLPVKKATVLYQGMRVKIQEQFKNGMMHGDKIHFYC
300310320330340
KNKEKKCSYTVEAHCRDGTIEIPSCFKEHSSLAFWKTDASELTPC
DescriptionBeta-2-glycoprotein 1
Gene name(s)Apoh
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_038503.4
none loaded Q01339
APOH_MOUSE
ENSMUST00000000049
none loaded GO:0060230
GO:0051918
GO:0051006
GO:0042627
GO:0034392
GO:0034364
GO:0034361
GO:0033033
GO:0031639
GO:0031012
GO:0030195
GO:0030193
GO:0016525
GO:0010596
GO:0009986
GO:0008201
GO:0007597
GO:0006641
GO:0005615
GO:0005543
GO:0001937

Peak Areas

Retention Times