File 20160309_MouseV2B12M6&7_refined_2017-12-11_11-13-57.sky.zip   
Description Ig kappa chain V-V region L7 (Fragment) OS=Mus musculus GN=Gm10881 PE=1 SV=1
Decoy false
Accession P01642
Note
View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MVSTPQFLVFLLFWIPASRGDILLTQSPAILSVSPGERVSFSCRASQSIGTSIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVES
1
101111
EDIADYYCQQSNSWP
Features
DescriptionIg kappa chain V-V region L7
Gene nameGm10881
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
none loaded none loaded P01642
KV5A9_MOUSE
none loaded none loaded GO:0003823
Display Chart Settings
 

Peak Areas

Retention Times