File 20160309_MouseV2B12M6&7_refined_2017-12-11_11-13-57.sky.zip   
Description Insulin-like growth factor II OS=Mus musculus GN=Igf2 PE=1 SV=1
Decoy false
Accession P09535
Note
View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MGIPVGKSMLVLLISLAFALCCIAAYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTSQAV
1
101111121131141151161171
LPDDFPRYPVGKFFQYDTWRQSAGRLRRGLPALLRARRGRMLAKELKEFREAKRHRPLIVLPPKDPAHGGASSEMSSNHQ
Features
DescriptionInsulin-like growth factor II (IGF-II) (Multiplication-stimulating polypeptide) [Cleaved into: Insulin-like growth factor II; Preptin]
Gene nameIgf2
Organism CLEAVED INTO:

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
none loaded none loaded P09535
IGF2_MOUSE
none loaded none loaded none loaded
Display Chart Settings
 

Peak Areas

Retention Times