View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MAPYRSSLLCALLLLALCALSPSHAATTSRGRAQERAPQSRVSEARPSTMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQ
101111121131141151161171181191
LRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATE
1
201211221231241251261271281291
VPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYK
301311321331341351361371381391
VSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVLPEGGETPLFKQFFKNWRDPDQT
401411421431441451461471481491
DGPGLGYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDE
501511521531541551561571581591
VAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQTAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAA
601611621631641651661671681691
YLWVGAGASEAEKTGAQELLKVLRSQHVQVEEGSEPDAFWEALGGKTAYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEVPGELMQEDLATDDVMLLD
701711721731741751761771
TWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQGFEPPSFVGWFLGWDDNYWSVDPLDRALAELAA
Features
Descriptiongelsolin [Source:MGI Symbol;Acc:MGI:95851] (g:26879, t:28239).
Gene name
Organism SOURCE:MGI SYMBOL;ACC:MGI:95851

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
none loaded none loaded P13020
GELS_MOUSE
none loaded none loaded none loaded
Display Chart Settings
 

Peak Areas

Retention Times