Protein / Label:sp|P13020|GELS_MOUSE
Description:Gelsolin OS=Mus musculus GN=Gsn PE=1 SV=3
Decoy:false
Note: 
File:20160309_MouseV2B12M6&7_refined_2017-12-11_11-13-57.sky.zip
0102030405060708090
MAPYRSSLLCALLLLALCALSPSHAATTSRGRAQERAPQSRVSEARPSTMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQ
100110120130140150160170180190
LRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRVVRATE
1
200210220230240250260270280290
VPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYK
300310320330340350360370380390
VSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVLPEGGETPLFKQFFKNWRDPDQT
400410420430440450460470480490
DGPGLGYLSSHIANVERVPFDAATLHTSTAMAAQHGMDDDGTGQKQIWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDE
500510520530540550560570580590
VAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQTAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAA
600610620630640650660670680690
YLWVGAGASEAEKTGAQELLKVLRSQHVQVEEGSEPDAFWEALGGKTAYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEVPGELMQEDLATDDVMLLD
700710720730740750760770
TWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQGFEPPSFVGWFLGWDDNYWSVDPLDRALAELAA
Descriptiongelsolin [Source:MGI Symbol;Acc:MGI:95851] (g:26879, t:28239).
Gene name(s)
Organisms SOURCE:MGI SYMBOL;ACC:MGI:95851

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded P13020
GELS_MOUSE
none loaded none loaded none loaded

Peak Areas

Retention Times