View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MKFLLLSTFIFLYSSLALARDKHYFIGITEAVWDYASGTEEKKLISVDTEQSNFYLQNGPDRIGRKYKKALYFEYTDGTFSKTIDKPAWLGFLGPVIKAE
101111121131141151161171181191
VEDKVYVHLKNLASRIYTFHAHGVTYTKEYEGAVYPDNTTDFQRADDKVLPGQQYVYVLHANEPSPGEGDSNCVTRIYHSHVDAPKDIASGLIGPLILCK
201211221231241251261271281291
KGSLYKEKEKNIDQEFVLMFSVVDENLSWYLEDNIKTFCSEPEKVDKDNEDFQESNRMYSINGYTFGSLPGLSMCAADRVKWYLFGMGNEVDVHSAFFHG
301311321331341351361371381391
QALTSRNYQTDIINLFPATLIDAYMVAQNPGVWMLSCQNLNHLKAGLQAFFQVRDCNKPSPEDNIQDRHVRHYYIAAEEVIWNYAPSGTDIFTGENLTAL
401411421431441451461471481491
ESDSRVFFEQGATRIGGSYKKMAYREYTDGSFTNRKQRGPDEEHLGILGPVIWAEVGDTIKVTFHNKGQHPLSIQPMGVSFTAENEGTYYGPPGRSSQQA
501511521531541551561571581591
ASHVAPKETFTYEWTVPKEMGPTYADPVCLSKMYYSGVDPTKDIFTGLIGPMKICKKGSLLADGRQKDVDKEFYLFPTVFDENESLLLDDNIRMFTTAPD
1
601611621631641651661671681691
QVDKEDEDFQESNKMHSMNGFMYGNQPGLNMCLGESIVWYLFSAGNEADVHGIYFSGNTYLSKGERRDTANLFPHKSLTLLMNPDTKGTFDVECLTTDHY
701711721731741751761771781791
TGGMKQKYTVNQCQRQFEDFTVYLGERTYYVAAVEVEWDYSPSRAWEKELHHLQEQNVSNVFLDKEEFFIGSKYKKVVYRQFTDSSFREQVKRRAEDEHL
801811821831841851861871881891
GILGPPIHANVGDKVKVVFKNMATRPYSIHAHGVKTESSTVVPTLPGEVRTYTWQIPERSGAGREDSACIPWAYYSTVDRVKDLYSGLIGPLIVCRKSYV
901911921931941951961971981991
KVFSPKKKMEFFLLFLVFDENESWYLDDNIKTYSEHPEKVNKDNEEFLESNKMHAINGKMFGNLQGLTMHVKDEVNWYVMGMGNEIDLHTVHFHGHSFQY
1001101110211031104110511061
KHRGVYSSDVFDLFPGTYQTLEMFPQTPGTWLLHCHVTDHVHAGMATTYTVLPVEQETKSG
Features
DescriptionCeruloplasmin
Gene nameCp
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes Molecular Functions
NP_001263177.1
NP_031778.2
none loaded Q61147
Q6P5C8
CERU_MOUSE
ENSMUST00000091309
none loaded GO:0004322
GO:0005507
GO:0005615
GO:0006825
GO:0006879
Copper transport
Ion transport
Transport
Oxidoreductase
Display Chart Settings
 

Peak Areas

Retention Times