0102030405060708090
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELD
100110120130140150160170180190
RAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTV
1
200210220230240250260270280
TNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
Features
DescriptionTropomyosin alpha-1 chain
Gene nameTpm1
Organism Rattus norvegicus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Molecular Functions
NP_001029241.1
NP_062004.1
NP_001029244.1
NP_001029247.1
NP_001029245.1
NP_001029246.1
none loaded P04692
P06469
P18342
P18343
P18344
P19354
Q53X09
Q63582
Q63608
Q63609
P58771
TPM1_RAT
TPM1_MOUSE
ENSRNOT00000024575
ENSRNOT00000024617
ENSRNOT00000048044
none loaded GO:0005737
GO:0005856
GO:0030049
GO:0030336
GO:0031529
GO:0032781
GO:0042060
GO:0045785
GO:0051496
Muscle protein
Display Chart Settings
 

Peak Areas

Retention Times