View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MSVFFYLFVLVFGLQATIHCAPHNSSEGKVTTCHLPQQNATLYKMPSINADFAFSLYRRLSVENPDLNIFFSPVSISVALAMLSFGSGSSTQTQILEVLG
101111121131141151161171181191
FNLTDTPVTELQQGFQHLICSLNFPKNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHKINSYVEKQTKGKIVGLIQGLKLNII
201211221231241251261271281291
MILVNYIHFRAQWANPFRVSKTEESSNFSVDKSTTVQVPMMHQLEQYYHYVDMELNCTVLQMDYSENALALFVLPKEGHMEWVEAAMSSKTLKKWNYLLQ
301311321331341351361371381391
KGWVELFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITEDSGLKLSYAFHKAVLHIGEEGTKEGASPEVGSLDQQEVPPLHPVIRLDRAFLLMILE
1
401411
KRTRSVLFLGKLVNPTKQ
Features
DescriptionThyroxine-binding globulin
Gene nameSerpina7
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
none loaded none loaded A2RSG7
P61939
THBG_MOUSE
none loaded none loaded GO:0004867
GO:0005576
GO:0005615
GO:0007568
GO:0009791
GO:0030162
GO:0033189
GO:0034695
GO:0042493
GO:0042562
GO:0043434
GO:0051412
Display Chart Settings
 

Peak Areas

Retention Times