Protein / Label:sp|O88968|TCO2_MOUSE
Description: 
Decoy:false
Note: 
File:20160620_Plasma_Exp1_B4_M2_refined_2017-10-31_12-20-18.sky.zip
0102030405060708090
MELLKALLLLSGVFGALAEFCVIPRIDSQLVEKLGQRLLPWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTSSDDNSSCQPKL
1
100110120130140150160170180190
SGGSLALYLLALRANCEFFGSRKGDRLISQLKWFLEDEKKAIGHNHEGHPNTNYYQYGLSILALCVHQKRLHDSVVGKLLYAVEHDYFTYQGHVSVDTEA
200210220230240250260270280290
MAGLALTCLERFNFNSDLRPRITMAIETVREKILKSQAPEGYFGNIYSTPLALQMLMTSPASGVGLGTACIKAGTSLLLSLQDGAFQNPLMISQLLPILN
300310320330340350360370380390
HKTYLDLIFPDCQASRVMLVPAVEDPVHISEVISVTLKVASALSPYEQTFFVFAGSSLEDVLKLAQDGGGFTYGTQASLSGPYLTSVLGKDAGDREYWQL
400410420
LRAPDTPLLQGIADYKPQDGETIELRLVRW
DescriptionTranscobalamin-2 (short name: TC-2)
Gene name(s)Tcn2
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001123930.1
NP_001123931.1
NP_056564.1
none loaded Q5SQ21
Q3UP69
Q3TD34
O88968
TCO2_MOUSE
ENSMUST00000109993
ENSMUST00000109992
ENSMUST00000109991
ENSMUST00000109990
ENSMUST00000109989
ENSMUST00000109988
ENSMUST00000020710
none loaded GO:0046872
GO:0031419
GO:0015889
GO:0009235
GO:0006824
GO:0005576

Peak Areas

Retention Times