View Settings
The number displayed on each peptide box is the rank
1112131415161718191
MELLKALLLLSGVFGALAEFCVIPRIDSQLVEKLGQRLLPWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTSSDDNSSCQPKL
1
101111121131141151161171181191
SGGSLALYLLALRANCEFFGSRKGDRLISQLKWFLEDEKKAIGHNHEGHPNTNYYQYGLSILALCVHQKRLHDSVVGKLLYAVEHDYFTYQGHVSVDTEA
201211221231241251261271281291
MAGLALTCLERFNFNSDLRPRITMAIETVREKILKSQAPEGYFGNIYSTPLALQMLMTSPASGVGLGTACIKAGTSLLLSLQDGAFQNPLMISQLLPILN
301311321331341351361371381391
HKTYLDLIFPDCQASRVMLVPAVEDPVHISEVISVTLKVASALSPYEQTFFVFAGSSLEDVLKLAQDGGGFTYGTQASLSGPYLTSVLGKDAGDREYWQL
401411421
LRAPDTPLLQGIADYKPQDGETIELRLVRW
Features
DescriptionTranscobalamin-2 (short name: TC-2)
Gene nameTcn2
Organism Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories Biological Processes
NP_001123930.1
NP_056564.1
NP_001123931.1
none loaded O88968
Q3TD34
Q3UP69
Q5SQ21
TCO2_MOUSE
ENSMUST00000020710
ENSMUST00000109988
ENSMUST00000109989
ENSMUST00000109990
ENSMUST00000109991
ENSMUST00000109992
ENSMUST00000109993
none loaded GO:0005576
GO:0006824
GO:0009235
GO:0015889
GO:0031419
GO:0046872
Cobalt transport
Ion transport
Transport
Display Chart Settings
 

Peak Areas

Retention Times