Protein / Label:sp|P26041|MOES_MOUSE
Description: 
Decoy:false
Note: 
File:20160620_Plasma_Exp1_B4_M2_refined_2017-10-31_12-20-18.sky.zip
0102030405060708090
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKAFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQR
100110120130140150160170180190
LFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEM
200210220230240250260270280290
YGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
300310320330340350360370380390
EVQQMKAQAREEKHQKQMERALLENEKKKRELAEKEKEKIEREKEELMEKLKQIEEQTKKAQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAK
400410420430440450460470480490
EALLQASRDQKKTQEQLASEMAELTARISQLEMARKKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEHDEQDENGAEASAELRADAMA
500510520530540550560570
KDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
1
DescriptionMoesin
Gene name(s)Msn
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_034963.2
none loaded Q8BSN4
Q3UL28
P26041
B1AX70
MOES_MOUSE
ENSMUST00000117399
none loaded GO:2000401
GO:0070062
GO:0050900
GO:0031528
GO:0030175
GO:0022614
GO:0019898
GO:0016324
GO:0016323
GO:0007159
GO:0005925
GO:0005856
GO:0005737
GO:0005730
GO:0003725
GO:0001931

Peak Areas

Retention Times