Protein / Label:sp|P10923|OSTP_MOUSE
Description: 
Decoy:false
Note: 
File:20160620_Plasma_Exp1_B4_M2_refined_2017-10-31_12-20-18.sky.zip
0102030405060708090
MRLAVICFCLFGIASSLPVKVTDSGSSEEKLYSLHPDPIATWLVPDPSQKQNLLAPQNAVSSEEKDDFKQETLPSNSNESHDHMDDDDDDDDDDGDHAES
100110120130140150160170180190
EDSVDSDESDESHHSDESDETVTASTQADTFTPIVPTVDVPNGRGDSLAYGLRSKSRSFQVSDEQYPDATDEDLTSHMKSGESKESLDVIPVAQLLSMPS
1
200210220230240250260270280290
DQDNNGKGSHESSQLDEPSLETHRLEHSKESQESADQSDVIDSQASSKASLEHQSHKFHSHKDKLVLDPKSKEDDRYLKFRISHELESSSSEVN
DescriptionOsteopontin
Gene name(s)Spp1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_033289.2
NP_001191162.1
none loaded Q91VH4
P19008
P10923
OSTP_MOUSE
ENSMUST00000112748
ENSMUST00000112747
ENSMUST00000031243
none loaded GO:0050840
GO:0045177
GO:0043066
GO:0031214
GO:0030593
GO:0010811
GO:0007155
GO:0005737
GO:0005615
GO:0005576
GO:0005125
GO:0001503

Peak Areas

Retention Times