Protein / Label:sp|P97807|FUMH_MOUSE
Description: 
Decoy:false
Note: 
File:20160620_Plasma_Exp1_B4_M2_refined_2017-10-31_12-20-18.sky.zip
0102030405060708090
MYRALRLLARSRRLLRVPSAGAAVSGEATTLPRCAPNVARMASQNSFRVEFDTFGELKVPTDKYYGAQTVRSTMNFKIGGATERMPIPVIQAFGILKRAA
1
100110120130140150160170180190
AEVNQEYGLDPKIASAIMKAADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKKPVHPNDHVNKSQSSNDTFPTAMHIAAAVEV
200210220230240250260270280290
HKVLLPGLQKLHDALSAKSKEFAQVIKIGRTHTQDAVPLTLGQEFSGYVQQVQYAMVRIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTGL
300310320330340350360370380390
PFVTAPNKFEALAAHDALVELSGAMNTAACSLMKIANDIRFLGSGPRSGLGELILPENEPGSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHF
400410420430440450460470480490
ELNVFKPMMIKNVLHSARLLGDASVSFTDNCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKP
500
KDMLGPK
DescriptionFumarate hydratase, mitochondrial (short name: Fumarase)
Gene name(s)Fh
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_034339.2
none loaded Q9DCX0
Q99JL0
Q3UIA9
P97807
FUMH_MOUSE
ENSMUST00000027810
none loaded GO:0048873
GO:0045239
GO:0006106
GO:0006099
GO:0005739
GO:0004333

Peak Areas

Retention Times