0102030405060708090
MEGPAFSKPLKDKINPWGPLIVLGILIRAGVSVQHDSPHQVFNVTWRVTNLMTGQTANATSLLGTMTDAFPKLYFDLCDLIGDDWDETGLGCRTPGGRKR
100110120130140150160170180190
ARTFDFYVCPGHTVPTGCGGPREGYCGKWGCETTGQAYWKPSSSWDLISLKRRNTPQNQGPCYDSSAVSSDIKGATPGGRCNPLVLEFTDAGKKASWDGP
200210220230240250260270280290
KVWGLRLYRSTGTDPVTRFSLTRQVLNIGPRVPIGPNPVITDQLPPSRPVQIMLPRPPQPPPPGAASIVPETAPPSQQPGTGDRLLNLVDGAYQALNLTS
300310320330340350360370380390
PDKTQECWLCLVAGPPYYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLAAPAGTIWACNTGLTPCLS
400410420430440450460470480490
TTVLDLTTDYCVLVELWPKVTYHSPGYVYGQFERKTKYKREPVSLTLALLLGGLTMGGIAAGVGTGTTALVATKQFEQLQAAIHTDLGALEKSVSALEKS
1
500510520530540550560570580590
LTSLSEVVLQNRRGLDLLFLKEGGLCAALKEECCFYADHTGVVRDSMAKLRERLNQRQKLFESGQGWFEGLFNRSPWFTTLISTIMGPLIILLLILLFGP
600610620630640
CILNRLVQFVKDRISVVQALVLTQQYHQLKSIDPEEVESRE
Features
DescriptionMLV-related proviral Env polyprotein [Cleaved into: Surface protein (SU); Transmembrane protein (TM)]
Gene name
Organism CLEAVED INTO:

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI Numbers GO Categories
none loaded none loaded P10404
ENV1_MOUSE
none loaded none loaded none loaded
Display Chart Settings
 

Peak Areas

Retention Times