Protein / Label:sp|P10649|GSTM1_MOUSE
Description: 
Decoy:false
Note: 
File:20160620_Plasma_Exp1_B4_M2_refined_2017-10-31_12-20-18.sky.zip
0102030405060708090
MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIV
100110120130140150160170180190
ENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKS
200210
SRYIATPIFSKMAHWSNK
1
DescriptionGlutathione S-transferase Mu 1
Gene name(s)Gstm1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_034488.1
none loaded Q58ET5
P10649
A2AE90
GSTM1_MOUSE
ENSMUST00000004140
none loaded GO:0046982
GO:0042803
GO:0035690
GO:0005737
GO:0004364

Peak Areas

Retention Times