Protein / Label:sp|P13634|CAH1_MOUSE
Description: 
Decoy:false
Note: 
File:20160620_Plasma_Exp1_B4_M2_refined_2017-10-31_12-20-18.sky.zip
0102030405060708090
MASADWGYGSENGPDQWSKLYPIANGNNQSPIDIKTSEANHDSSLKPLSISYNPATAKEIVNVGHSFHVIFDDSSNQSVLKGGPLADSYRLTQFHFHWGN
100110120130140150160170180190
SNDHGSEHTVDGTRYSGELHLVHWNSAKYSSASEAISKADGLAILGVLMKVGPANPSLQKVLDALNSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLT
1
200210220230240250260
HPPLHESVTWVICKDSISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF
DescriptionCarbonic anhydrase 1
Gene name(s)Ca1
Organisms Mus musculus

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001077426.1
NP_033929.2
none loaded Q9DC84
Q3TS19
P13634
CAH1_MOUSE
ENSMUST00000181860
ENSMUST00000094365
none loaded GO:0008270
GO:0006730
GO:0005794
GO:0004089

Peak Areas

Retention Times