Protein / Label:SSR1.IPI00301021
Description:IPI:IPI00301021.3|SWISS-PROT:P43307-1|ENSEMBL:ENSP00000244763|REFSEQ:NP_003135|H-INV:HIT000071987|VEGA:OTTHUMP00000015998 Tax_Id=9606 Gene_Symbol=SSR1 Isoform 1 of Translocon-associated protein subunit alpha
Decoy:false
Note: 
File:8_point_1000ng_SNU target_v2_2015-04-09_15-07-41.sky.zip
0102030405060708090
MRLLPRLLLLLLLVFPATVLFRGGPRGLLAVAQDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEEDVSGEPEASPSADTTILFVKGEDFPANNI
1 >>
100110120130140150160170180190
VKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIERE
> 1
200210220230240250260270280
DGLDGETIFMYMFLAGLGLLVIVGLHQLLESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
DescriptionTranslocon-associated protein subunit alpha (short name: TRAP-alpha)
Gene name(s)SSR1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_003135
NP_003135.2
none loaded P43307-1
Q9UN49
Q9TNQ8
Q96IA2
Q8NBH9
Q6IB43
Q5TAM3
Q53H19
Q53GX2
P43307
A8K685
SSRA_HUMAN
ENSP00000244763
ENST00000244763
IPI00301021
GO:0016021
GO:0008284
GO:0006987
GO:0006614
GO:0006412
GO:0005789

Peak Areas

Retention Times