Protein / Label:SLC25A1.IPI00294159
Description:IPI:IPI00294159.3|SWISS-PROT:P53007|TREMBL:Q6LAP8|ENSEMBL:ENSP00000215882|REFSEQ:NP_005975|H-INV:HIT000193967|VEGA:OTTHUMP00000028859;OTTHUMP00000196366 Tax_Id=9606 Gene_Symbol=SLC25A1 Tricarboxylate transport protein, mitochondrial
Decoy:false
Note: 
File:8_point_1000ng_SNU target_v2_2015-04-09_15-07-41.sky.zip
0102030405060708090
MPAPRAPRALAAAAPASGKAKLTHPGKAILAGGLAGGIEICITFPTEYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGLSSLLYGSIPKAAV
1
100110120130140150160170180190
RFGMFEFLSNHMRDAQGRLDSTRGLLCGLGAGVAEAVVVVCPMETIKVKFIHDQTSPNPKYRGFFHGVREIVREQGLKGTYQGLTATVLKQGSNQAIRFF
200210220230240250260270280290
VMTSLRNWYRGDNPNKPMNPLITGVFGAIAGAASVFGNTPLDVIKTRMQGLEAHKYRNTWDCGLQILKKEGLKAFYKGTVPRLGRVCLDVAIVFVIYDEV
1
300310
VKLLNKVWKTD
DescriptionTricarboxylate transport protein, mitochondrial
Gene name(s)SLC25A1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_005975
NP_005975.1
none loaded Q6LAP8
Q9BSK6
P53007
A8K8E8
TXTP_HUMAN
ENSP00000215882
ENST00000598008
ENST00000215882
IPI00294159
GO:0044281
GO:0035338
GO:0019432
GO:0016021
GO:0015137
GO:0006843
GO:0006094
GO:0005743

Peak Areas

Retention Times