Protein / Label:RPS8.IPI00216587
Description:IPI:IPI00216587.9|SWISS-PROT:P62241|TREMBL:Q5JR94|ENSEMBL:ENSP00000379888|REFSEQ:NP_001003|H-INV:HIT000264374|VEGA:OTTHUMP00000010160 Tax_Id=9606 Gene_Symbol=RPS8 40S ribosomal protein S8
Decoy:false
Note: 
File:8_point_1000ng_SNU target_v2_2015-04-09_15-07-41.sky.zip
0102030405060708090
MGISRDNWHKRRKTGGKRKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNC
1 <
100110120130140150160170180190
IVLIDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLR
<< 1
200
KIKARKGK
Description40S ribosomal protein S8
Gene name(s)RPS8
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001003.1
NP_001003
none loaded Q5JR94
Q6IRL7
P62241
P09058
RS8_HUMAN
ENSP00000379888
ENST00000396651
IPI00216587
GO:0022627
GO:0019083
GO:0006614
GO:0006415
GO:0006414
GO:0006413
GO:0003735
GO:0000462
GO:0000184

Peak Areas

Retention Times