Protein / Label:PTPN1.IPI00297261
Description:IPI:IPI00297261.3|SWISS-PROT:P18031|TREMBL:A8K3M3;B4DSN5|ENSEMBL:ENSP00000360683|REFSEQ:NP_002818|H-INV:HIT000037246|VEGA:OTTHUMP00000031266 Tax_Id=9606 Gene_Symbol=PTPN1 Tyrosine-protein phosphatase non-receptor type 1
Decoy:false
Note: 
File:8_point_1000ng_SNU target_v2_2015-04-09_15-07-41.sky.zip
0102030405060708090
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVW
1
100110120130140150160170180190
EQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRE
1
200210220230240250260270280290
SGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
300310320330340350360370380390
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDED
400410420430
HALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT
DescriptionTyrosine-protein phosphatase non-receptor type 1
Gene name(s)PTPN1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_002818
NP_001265547.1
NP_002818.1
none loaded Q9NQQ4
Q9BQV9
Q5TGD8
P18031
B4DSN5
A8K3M3
PTN1_HUMAN
ENSP00000360683
ENST00000371621
IPI00297261
GO:1902202
GO:0060397
GO:0060338
GO:0060337
GO:0060334
GO:0060333
GO:0046627
GO:0035791
GO:0031532
GO:0031410
GO:0030968
GO:0030168
GO:0030100
GO:0008286
GO:0008270
GO:0005829
GO:0005789
GO:0005783
GO:0005769
GO:0004725

Peak Areas

Retention Times