Protein / Label:PCNA.IPI00021700
Description:IPI:IPI00021700.3|SWISS-PROT:P12004|TREMBL:B4DUA2;Q6FHF5;Q6FI35;Q7Z6A1;Q7Z6A2;Q7Z6A3|ENSEMBL:ENSP00000368438;ENSP00000368458|REFSEQ:NP_002583;NP_872590|H-INV:HIT000298775|VEGA:OTTHUMP00000030189;OTTHUMP00000030190 Tax_Id=9606 Gene_Symbol=PCNA Proliferating cell nuclear antigen
Decoy:false
Note: 
File:8_point_1000ng_SNU target_v2_2015-04-09_15-07-41.sky.zip
0102030405060708090
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLA
100110120130140150160170180190
LVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMN
1 1
200210220230240250260
EPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
DescriptionProliferating cell nuclear antigen (short name: PCNA)
Gene name(s)PCNA
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_002583
NP_872590
NP_872590.1
NP_002583.1
none loaded Q7Z6A2
Q7Z6A1
Q7Z6A3
Q6FHF5
B4DUA2
Q6FI35
P12004
D3DW02
B2R897
PCNA_HUMAN
ENSP00000368458
ENSP00000368438
ENST00000379160
ENST00000379143
IPI00021700
GO:0070557
GO:0048015
GO:0046686
GO:0043626
GO:0043596
GO:0033993
GO:0032405
GO:0032201
GO:0032139
GO:0032077
GO:0030337
GO:0019985
GO:0015630
GO:0008283
GO:0007507
GO:0006298
GO:0006297
GO:0006284
GO:0006283
GO:0006275
GO:0006271
GO:0005737
GO:0005663
GO:0005654
GO:0000722
GO:0000701
GO:0000083

Peak Areas

Retention Times