Protein / Label:MARS.IPI00008240
Description:IPI:IPI00008240.2|SWISS-PROT:P56192|TREMBL:A8K492;B3KVK7|ENSEMBL:ENSP00000262027|REFSEQ:NP_004981|H-INV:HIT000101864|VEGA:OTTHUMP00000168165 Tax_Id=9606 Gene_Symbol=MARS Methionyl-tRNA synthetase, cytoplasmic
Decoy:false
Note: 
File:8_point_1000ng_SNU target_v2_2015-04-09_15-07-41.sky.zip
0102030405060708090
MRLFVSDGVPGCLPVLAAAGRARGRAEVLISTVGPEDCVVPFLTRPKVPVLQLDSGNYLFSTSAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAAL
1
100110120130140150160170180190
YYLVVQGKKGEDVLGSVRRALTHIDHSLSRQNCPFLAGETESLADIVLWGALYPLLQDPAYLPEELSALHSWFQTLSTQEPCQRAAETVLKQQGVLALRP
200210220230240250260270280290
YLQKQPQPSPAEGRAVTNEPEEEELATLSEEEIAMAVTAWEKGLESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRL
300310320330340350360370380390
RQWNTLYLCGTDEYGTATETKALEEGLTPQEICDKYHIIHADIYRWFNISFDIFGRTTTPQQTKITQDIFQQLLKRGFVLQDTVEQLRCEHCARFLADRF
1
400410420430440450460470480490
VEGVCPFCGYEEARGDQCDKCGKLINAVELKKPQCKVCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLK
500510520530540550560570580590
WGTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWWKNPEQVDLYQFMAKDNVPFHSLVFPCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGV
600610620630640650660670680690
GVFGDMAQDTGIPADIWRFYLLYIRPEGQDSAFSWTDLLLKNNSELLNNLGNFINRAGMFVSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQLLEKVR
700710720730740750760770780790
IRDALRSILTISRHGNQYIQVNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPYMPTVSATIQAQLQLPPPACSILLTNFLCTLPAGHQIGTVSP
800810820830840850860870880890
LFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVAEGKPPEAPKGKKKK
DescriptionMethionine--tRNA ligase, cytoplasmic
Gene name(s)MARS
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_004981
NP_004981.2
none loaded B3KVK7
A8K492
Q9NSE0
Q96BZ0
Q96A15
Q53H14
Q14895
P56192
SYMC_HUMAN
ENSP00000262027
ENST00000262027
IPI00008240
GO:0006431
GO:0006418
GO:0005829
GO:0005739
GO:0005524
GO:0004825
GO:0000049

Peak Areas

Retention Times