File 8_point_1000ng_SNU target_v2_2015-04-09_15-07-41.sky.zip
Description IPI:IPI00007321.2|TREMBL:B4DJV9|ENSEMBL:ENSP00000397807 Tax_Id=9606 Gene_Symbol=LYPLA1 cDNA FLJ60607, highly similar to Acyl-protein thioesterase 1
Decoy false
Note
Reproducibility Report
0102030405060708090
MCGGPAQPAAATALREAPEKNPLFRLRCELRRCMCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNV
100110120130140150160170180190
AMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISIL
1
200210220230240250260
QCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID
1
DescriptionIPI:IPI00007321.2|TREMBL:B4DJV9|ENSEMBL:ENSP00000397807 Tax_Id=9606 Gene_Symbol=LYPLA1 cDNA FLJ60607, highly similar to Acyl-protein thioesterase 1
Gene name(s)LYPLA1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded B4DJV9
none loaded ENSP00000397807
IPI00007321
none loaded

Peak Areas

Retention Times