Protein / Label:LANCL2.IPI00032995
Description:IPI:IPI00032995.1|SWISS-PROT:Q9NS86|TREMBL:B3KTN5;B4DWZ7;Q6NSL4|ENSEMBL:ENSP00000254770|REFSEQ:NP_061167|H-INV:HIT000246431|VEGA:OTTHUMP00000025397;OTTHUMP00000159664 Tax_Id=9606 Gene_Symbol=LANCL2 LanC-like protein 2
Decoy:false
Note: 
File:8_point_1000ng_SNU target_v2_2015-04-09_15-07-41.sky.zip
0102030405060708090
MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDC
100110120130140150160170180190
SAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGR
200210220230240250260270280290
AGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKK
300310320330340350360370380390
FRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWC
1
400410420430440
LDYGAHGCRIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFELDSSKRD
1
DescriptionLanC-like protein 2
Gene name(s)LANCL2
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_061167.1
NP_061167
none loaded B3KTN5
B4DWZ7
Q9NS86
Q9BSR1
Q8TCQ3
Q6NSL4
B2R8D4
LANC2_HUMAN
ENSP00000254770
ENST00000254770
IPI00032995
GO:0070273
GO:0045892
GO:0032266
GO:0030864
GO:0010314
GO:0009789
GO:0008152
GO:0005886
GO:0005829
GO:0005634
GO:0005525
GO:0005524
GO:0003824

Peak Areas

Retention Times