Protein / Label:HSD17B10.IPI00017726
Description:IPI:IPI00017726.1|SWISS-PROT:Q99714-1|TREMBL:Q6IBS9|ENSEMBL:ENSP00000168216|REFSEQ:NP_004484|H-INV:HIT000222808|VEGA:OTTHUMP00000023348 Tax_Id=9606 Gene_Symbol=HSD17B10 Isoform 1 of 3-hydroxyacyl-CoA dehydrogenase type-2
Decoy:false
Note: 
File:8_point_1000ng_SNU target_v2_2015-04-09_15-07-41.sky.zip
0102030405060708090
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKT
1
100110120130140150160170180190
YNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGL
1
200210220230240250260
FGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
Description3-hydroxyacyl-CoA dehydrogenase type-2
Gene name(s)HSD17B10
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_004484.1
NP_004484
NP_001032900.1
none loaded Q99714-1
Q99714
Q96HD5
Q8TCV9
Q6IBS9
Q5H927
HCD2_HUMAN
ENSP00000168216
ENST00000601615
ENST00000595128
ENST00000375304
ENST00000168216
IPI00017726
GO:0047015
GO:0034641
GO:0030283
GO:0009083
GO:0008709
GO:0008033
GO:0006629
GO:0005886
GO:0005783
GO:0005759
GO:0005743
GO:0003857

Peak Areas

Retention Times