Protein / Label:CYC1.IPI00029264
Description:IPI:IPI00029264.3|SWISS-PROT:P08574|TREMBL:Q8TBT6|ENSEMBL:ENSP00000317159|REFSEQ:NP_001907|H-INV:HIT000009907|VEGA:OTTHUMP00000178381 Tax_Id=9606 Gene_Symbol=CYC1 Cytochrome c1, heme protein, mitochondrial
Decoy:false
Note: 
File:8_point_1000ng_SNU target_v2_2015-04-09_15-07-41.sky.zip
0102030405060708090
MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRG
<
100110120130140150160170180190
LLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYI
<< 1
200210220230240250260270280290
VRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLV
1
300310320
PLVYTIKRHKWSVLKSRKLAYRPPK
DescriptionIPI:IPI00029264.3|SWISS-PROT:P08574|TREMBL:Q8TBT6|ENSEMBL:ENSP00000317159|REFSEQ:NP_001907|H-INV:HIT000009907|VEGA:OTTHUMP00000178381 Tax_Id=9606 Gene_Symbol=CYC1 Cytochrome c1, heme protein, mito...
Gene name(s)CYC1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001907
none loaded Q8TBT6
P08574
none loaded ENSP00000317159
IPI00029264
none loaded

Peak Areas

Retention Times