Protein / Label:ANPEP.IPI00221224
Description:IPI:IPI00221224.6|SWISS-PROT:P15144|TREMBL:B4DP01;B4DP96;B4DPH5;B4DV63;Q59E93;Q71E46;Q8IVL7|ENSEMBL:ENSP00000300060|REFSEQ:NP_001141|H-INV:HIT000194832|VEGA:OTTHUMP00000176763;OTTHUMP00000194690 Tax_Id=9606 Gene_Symbol=ANPEP Aminopeptidase N
Decoy:false
Note: 
File:8_point_1000ng_SNU target_v2_2015-04-09_15-07-41.sky.zip
0102030405060708090
MAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGL
100110120130140150160170180190
YVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYME
200210220230240250260270280290
GNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI
300310320330340350360370380390
RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVT
1
400410420430440450460470480490
IEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKGASVLRMLSSFLSEDVFKQGL
500510520530540550560570580590
ASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY
600610620630640650660670680690
WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQIINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALS
700710720730740750760770780790
SLSYFKLMFDRSEVYGPMKNYLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWMENPNNNPIHPNLRSTVYCNA
800810820830840850860870880890
IAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWILNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN
1
900910920930940950960
LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK
DescriptionAminopeptidase N (short name: AP-N)
Gene name(s)ANPEP
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001141
XP_005254949.1
NP_001141.2
none loaded Q59E93
B4DPH5
Q8IVL7
B4DV63
B4DP01
B4DP96
Q71E46
Q9UCE0
Q8IVH3
Q8IUK3
Q6GT90
Q16728
P15144
AMPN_HUMAN
ENSP00000300060
ENST00000300060
IPI00221224
GO:0044267
GO:0030154
GO:0016032
GO:0009897
GO:0009615
GO:0008270
GO:0008237
GO:0006508
GO:0005887
GO:0005829
GO:0005793
GO:0005765
GO:0004872
GO:0004177
GO:0002003
GO:0001618
GO:0001525

Peak Areas

Retention Times