Protein / Label:ACADVL.IPI00028031.sp|P49748|
Description:IPI:IPI00028031.2|TREMBL:B4DEA8;Q53HR2|ENSEMBL:ENSP00000349297|VEGA:OTTHUMP00000128351;OTTHUMP00000182787 Tax_Id=9606 Gene_Symbol=ACADVL cDNA FLJ56425, highly similar to Very-long-chain specific acyl-CoAdehydrogenase, mitochondrial
Decoy:false
Note: 
File:8_point_1000ng_SNU target_v2_2015-04-09_15-07-41.sky.zip
0102030405060708090
MPRGPQPSAARCTVDDESGLGAPGRGRAGRQSWVRARASGARRDSEMQAARMAASLGRQLLRLGGGSSRLTALLGQPRPGPARRPYAGGAAQLALDKSDS
100110120130140150160170180190
HPSDALTRKKPAKAESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPVSRFFEEVNDPAKNDALEMVEETTWQGLKELGAFGLQVPSELGGVG
200210220230240250260270280290
LCNTQYARLVEIVGMHDLGVGITLGAHQSIGFKGILLFGTKAQKEKYLPKLASGETVAAFCLTEPSSGSDAASIRTSAVPSPCGKYYTLNGSKLWISNGG
300310320330340350360370380390
LADIFTVFAKTPVTDPATGAVKEKITAFVVERGFGGITHGPPEKKMGIKASNTAEVFFDGVRVPSENVLGEVGSGFKVAMHILNNGRFGMAAALAGTMRG
1 1
400410420430440450460470480490
IIAKAVDHATNRTQFGEKIHNFGLIQEKLARMVMLQYVTESMAYMVSANMDQGATDFQIEAAISKIFGSEAAWKVTDECIQIMGGMGFMKEPGVERVLRD
500510520530540550560570580590
LRIFRIFEGTNDILRLFVALQGCMDKGKELSGLGSALKNPFGNAGLLLGEAGKQLRRRAGLGSGLSLSGLVHPELSRSGELAVRALEQFATVVEAKLIKH
600610620630640650660670680690
KKGIVNEQFLLQRLADGAIDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQSDPWQQELYRNFKSISKALVERGGVVTSNPLG
700
F
DescriptionIPI:IPI00028031.2|TREMBL:B4DEA8;Q53HR2|ENSEMBL:ENSP00000349297|VEGA:OTTHUMP00000128351;OTTHUMP00000182787 Tax_Id=9606 Gene_Symbol=ACADVL cDNA FLJ56425, highly similar to Very-long-chain specific a...
Gene name(s)ACADVL
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded Q53HR2
B4DEA8
none loaded ENSP00000349297
IPI00028031
none loaded

Peak Areas

Retention Times