Protein / Label:NCOA3_HUMAN
Description:Nuclear receptor coactivator 3; Short=NCoA-3; EC=2.3.1.48; AltName: Full=ACTR; AltName: Full=Amplified in breast cancer 1 protein; Short=AIB-1; AltName: Full=CBP-interacting protein; Short=pCIP; AltName: Full=Class E basic helix-loop-helix protein 42; Short=bHLHe42; AltName: Full=Receptor-associated coactivator 3; Short=RAC-3; AltName: Full=Steroid receptor coactivator protein 3; Short=SRC-3; AltName: Full=Thyroid hormone receptor activator molecule 1; Short=TRAM-1; Accession=Q9UPG7; [Homo sapiens (Human)]
Decoy:false
Note:sp|Q9Y6Q9|
File:NCOA3_HUMAN_LLQNGNSPAEVAK_pnnl_B2_P56_2016-05-17_15-41-48.sky.zip
0102030405060708090
MSGLGENLDPLASDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDIDNFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADV
100110120130140150160170180190
SSTGQGVIDKDSLGPLLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNGVSWTNETQRQKSHTFNCRML
200210220230240250260270280290
MKTPHDILEDINASPEMRQRYETMQCFALSQPRAMMEEGEDLQSCMICVARRITTGERTFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC
300310320330340350360370380390
IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDRHGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGG
400410420430440450460470480490
MSMSPNQGLQMPSSRAYGLADPSTTGQMSGARYGGSSNIASLTPGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNIMISPRNRGSPKIASHQFSPV
500510520530540550560570580590
AGVHSPMASSGNTGNHSFSSSSLSALQAISEGVGTSLLSTLSSPGPKLDNSPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKE
600610620630640650660670680690
SSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVSSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAK
1
700710720730740750760770780790
ITAEATGKDTSSITSCGDGNVVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCTSSTIPSSSQEKDPKIKTETSEEGSGDLDNL
800810820830840850860870880890
DAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLKSSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGS
900910920930940950960970980990
SMGGPNRNVTVTQTPSSGDWGLPNSKAGRMEPMNSNSMGRPGGDYNTSLPRPALGGSIPTLPLRSNSIPGARPVLQQQQQMLQMRPGEIPMGMGANPYGQ
1000101010201030104010501060107010801090
AAASNQLGSWPDGMLSMEQVSHGTQNRPLLRNSLDDLVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALGIPELVNQGQALEPKQDAFQGQEA
1100111011201130114011501160117011801190
AVMMDQKAGLYGQTYPAQGPPMQGGFHLQGQSPSFNSMMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMENPTA
1200121012201230124012501260127012801290
GGAAVMRPMMQPQVSSQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQQQQQQQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPT
1300131013201330134013501360137013801390
MPQAPPQQFPYQPNYGMGQQPDPAFGRVSSPPNAMMSSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQGNPAVYSMVHMNGSSG
140014101420
HMGQMNMNPMPMSGMPMGPDQKYC
DescriptionNuclear receptor coactivator 3; Short=NCoA-3; EC=2.3.1.48; AltName: Full=ACTR; AltName: Full=Amplified in breast cancer 1 protein; Short=AIB-1; AltName: Full=CBP-interacting protein; Short=pCIP; A...
Gene name(s)
Organisms HOMO SAPIENS

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded none loaded none loaded none loaded none loaded none loaded

Peak Areas

Retention Times