Protein / Label:AURKB_HUMAN
Description:Aurora kinase B OS=Homo sapiens (Human) GN=AURKB PE=1 SV=3
Decoy:false
Note:sp|Q96GD4|
File:AURKB_HUMAN_SNVQPTAAPGQK_pnnl_B2_P5_20160517_2016-05-17_14-43-58.sky.zip
0102030405060708090
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSH
1
100110120130140150160170180190
FIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIMEELADALMYCHGKKVIHRD
200210220230240250260270280290
IKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
300310320330340
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
DescriptionAurora kinase B
Gene name(s)AURKB
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
XP_005256912.1
NP_001271455.1
NP_004208.2
NP_001243763.1
XP_005256911.1
none loaded Q9UQ46
Q96GD4
Q96DV5
O95083
O60446
O14630
D3DTR4
C7G535
C7G534
C7G533
B4DNM4
AURKB_HUMAN
ENST00000585124
ENST00000578549
ENST00000535053
ENST00000534871
none loaded GO:0051983
GO:0051256
GO:0046872
GO:0046777
GO:0043988
GO:0043146
GO:0036089
GO:0035174
GO:0034644
GO:0034501
GO:0032467
GO:0032133
GO:0032091
GO:0031145
GO:0030496
GO:0010369
GO:0008608
GO:0008283
GO:0007568
GO:0005829
GO:0005819
GO:0005524
GO:0004712
GO:0002903
GO:0000780
GO:0000122

Peak Areas

Retention Times