Protein / Label:VAV_HUMAN
Description:Proto-oncogene vav OS=Homo sapiens (Human) GN=VAV1 PE=1 SV=4
Decoy:false
Note:sp|P15498|
File:VAV_HUMAN_YCSQVESASK_pnnl_B2_P88_20160511_2016-05-11_17-12-58.sky.zip
0102030405060708090
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREVNLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLF
100110120130140150160170180190
DVQDFGKVIYTLSALSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLR
200210220230240250260270280290
EIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
1
300310320330340350360370380390
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLALDAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHY
400410420430440450460470480490
GRPKIDGELKITSVERRSKMDRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQGYELFFKTRELKKKWMEQFE
500510520530540550560570580590
MAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHRCRASAHKECLGRVPPCGRHGQDFPGTMKKDKLHRRAQDKKRNELGLPKMEVF
600610620630640650660670680690
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYVHGPPQDLSVHLWYAGPMERAGAESILANRSDGTFLVRQRVK
700710720730740750760770780790
DAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSE
800810820830840
LSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC
DescriptionProto-oncogene vav
Gene name(s)VAV1
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001245136.1
NP_005419.2
none loaded Q15860
P15498
M0QXX6
B4DVK9
VAV_HUMAN
ENST00000602142
ENST00000596764
none loaded GO:0097190
GO:0048015
GO:0048011
GO:0046872
GO:0045785
GO:0045087
GO:0043065
GO:0042110
GO:0038096
GO:0038095
GO:0032314
GO:0031295
GO:0030676
GO:0030168
GO:0008543
GO:0007264
GO:0007229
GO:0007173
GO:0005886
GO:0005829
GO:0005085
GO:0003700

Peak Areas

Retention Times