Protein / Label:CDK1_HUMAN
Description:Cyclin-dependent kinase 1; Short=CDK1; EC=2.7.11.22; EC=2.7.11.23; AltName: Full=Cell division control protein 2 homolog; AltName: Full=Cell division protein kinase 1; AltName: Full=p34 protein kinase; Accession=P06493; A8K7C4; C9J497; O60764; [Homo sapiens (Human)]
Decoy:false
Note:sp|P06493|
File:CPTAC_MRM_PNNL_Batch1_Exp1_Part2_20160520_2016-05-20_15-23-31.sky.zip
0102030405060708090
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQYM
1
100110120130140150160170180190
DSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATK
200210220230240250260270280290
KPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
DescriptionCyclin-dependent kinase 1; Short=CDK1; EC=2.7.11.22; EC=2.7.11.23; AltName: Full=Cell division control protein 2 homolog; AltName: Full=Cell division protein kinase 1; AltName: Full=p34 protein ki...
Gene name(s)
Organisms HOMO SAPIENS

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
none loaded none loaded none loaded none loaded none loaded none loaded none loaded

Peak Areas

Retention Times