Protein / Label:SRF_HUMAN
Description:Serum response factor OS=Homo sapiens GN=SRF PE=1 SV=1
Decoy:false
Note:sp|P11831|
File:PRISM_SRF_HUMAN_ALIQTCLNSPDSPPR_exp01_2016-07-25_17-16-20.sky.zip
0102030405060708090
MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREAAAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKR
100110120130140150160170180190
SLSEMEIGMVVGGPEASAAATGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTGTQVLLLVASETGHVYTFATR
200210220230240250260270280290
KLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATGFEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
1
300310320330340350360370380390
NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAIQVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVP
400410420430440450460470480490
TTVGGHMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQAGSSSNLTELQVVNLD
500
TAHSTKSE

Peak Areas

Retention Times