Protein / Label:ATF3_HUMAN
Description:Cyclic AMP-dependent transcription factor ATF-3 OS=Homo sapiens GN=ATF3 PE=1 SV=2
Decoy:false
Note:sp|P18847|
File:PRISM_ATF2_HUMAN_NLFIQQIK_exp01_2016-07-25_17-08-49.sky.zip
0102030405060708090
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAA
100110120130140150160170180
AKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
1
DescriptionCyclic AMP-dependent transcription factor ATF-3 (short name: cAMP-dependent transcription factor ATF-3)
Gene name(s)ATF3
Organisms Homo sapiens

Genbank IDs GIs Swiss-Prot Accessions Swiss-Prot Names Ensembl IPI numbers GO Categories
NP_001193415.1
NP_001193417.2
NP_001025458.1
NP_001665.1
NP_001035709.1
NP_001193413.2
XP_005273203.1
none loaded Q8WYM6
Q7Z566
Q6ICQ9
Q5VTZ2
P18847
ATF3_HUMAN
ENST00000464547
ENST00000366987
ENST00000366985
ENST00000366983
ENST00000341491
ENST00000336937
none loaded GO:0045892
GO:0044267
GO:0043565
GO:0035914
GO:0008284
GO:0006987
GO:0006351
GO:0006094
GO:0005730
GO:0005654
GO:0003714
GO:0003700

Peak Areas

Retention Times